Lineage for d1sm2b_ (1sm2 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544952Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2544953Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2544988Domain d1sm2b_: 1sm2 B: [105755]
    complexed with stu

Details for d1sm2b_

PDB Entry: 1sm2 (more details), 2.3 Å

PDB Description: Crystal structure of the phosphorylated Interleukin-2 tyrosine kinase catalytic domain
PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d1sm2b_:

Sequence, based on SEQRES records: (download)

>d1sm2b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsryss
ksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwke
rpedrpafsrllrqlaeiae

Sequence, based on observed residues (ATOM records): (download)

>d1sm2b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegk
ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia
e

SCOPe Domain Coordinates for d1sm2b_:

Click to download the PDB-style file with coordinates for d1sm2b_.
(The format of our PDB-style files is described here.)

Timeline for d1sm2b_: