Lineage for d1sm1y_ (1sm1 Y:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043709Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 3043766Domain d1sm1y_: 1sm1 Y: [105752]
    complexed with dol

Details for d1sm1y_

PDB Entry: 1sm1 (more details), 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin
PDB Compounds: (Y:) 50S ribosomal protein L31

SCOPe Domain Sequences for d1sm1y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm1y_ i.1.1.2 (Y:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
krfgdsyrrgskk

SCOPe Domain Coordinates for d1sm1y_:

Click to download the PDB-style file with coordinates for d1sm1y_.
(The format of our PDB-style files is described here.)

Timeline for d1sm1y_: