SCOPe 2.01: Domain d1sm1u_: 1sm1 U:

Lineage for d1sm1u_ (1sm1 U:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1sm1u_: 1sm1 U: [105749]
   complexed with dol

Details for d1sm1u_

PDB Entry: 1sm1, 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1sm1u_:

Sequence; same for both SEQRES and ATOM records:

>d1sm1u_ i.1.1.2 (U:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaqte

Timeline for d1sm1u_:

• d1sm1u_ first appeared in SCOP 1.69
  
• d1sm1u_ appears in SCOP 1.75
  
• d1sm1u_ appears in SCOPe 2.02
  
• d1sm1u_ appears in the current release, SCOPe 2.08