SCOPe 2.07: Domain d1sm1s_: 1sm1 S:

Lineage for d1sm1s_ (1sm1 S:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1sm1s_: 1sm1 S: [105747]
   complexed with dol

Details for d1sm1s_

PDB Entry: 1sm1, 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

PDB Compounds: (S:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1sm1s_:

Sequence; same for both SEQRES and ATOM records:

>d1sm1s_ i.1.1.2 (S:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti

Timeline for d1sm1s_:

• d1sm1s_ first appeared in SCOP 1.69
  
• d1sm1s_ appears in SCOPe 2.06
  
• d1sm1s_ appears in the current release, SCOPe 2.08