Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
Domain d1sm1o_: 1sm1 O: [105743] complexed with dol |
PDB Entry: 1sm1 (more details), 3.42 Å
SCOPe Domain Sequences for d1sm1o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm1o_ i.1.1.2 (O:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]} praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
Timeline for d1sm1o_:
View in 3D Domains from other chains: (mouse over for more information) d1sm11_, d1sm12_, d1sm13_, d1sm14_, d1sm1a_, d1sm1b_, d1sm1c_, d1sm1d_, d1sm1e_, d1sm1f_, d1sm1g_, d1sm1h_, d1sm1i_, d1sm1j_, d1sm1k_, d1sm1l_, d1sm1m_, d1sm1n_, d1sm1p_, d1sm1q_, d1sm1r_, d1sm1s_, d1sm1t_, d1sm1u_, d1sm1w_, d1sm1x_, d1sm1y_, d1sm1z_ |