Lineage for d1slja1 (1slj A:35-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399747Protein S1-domain of Ribonuclease E [110198] (1 species)
  7. 2399748Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
    Uniprot P21513 35-125
  8. 2399753Domain d1slja1: 1slj A:35-125 [105718]
    Other proteins in same PDB: d1slja2

Details for d1slja1

PDB Entry: 1slj (more details)

PDB Description: solution structure of the s1 domain of rnase e from e. coli
PDB Compounds: (A:) Ribonuclease E

SCOPe Domain Sequences for d1slja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slja1 b.40.4.5 (A:35-125) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]}
eqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvl
regqevivqidkeergnkgaalttfislags

SCOPe Domain Coordinates for d1slja1:

Click to download the PDB-style file with coordinates for d1slja1.
(The format of our PDB-style files is described here.)

Timeline for d1slja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slja2