Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein S1-domain of Ribonuclease E [110198] (1 species) |
Species Escherichia coli [TaxId:562] [110199] (3 PDB entries) Uniprot P21513 35-125 |
Domain d1slja1: 1slj A:35-125 [105718] Other proteins in same PDB: d1slja2 |
PDB Entry: 1slj (more details)
SCOPe Domain Sequences for d1slja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slja1 b.40.4.5 (A:35-125) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} eqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvl regqevivqidkeergnkgaalttfislags
Timeline for d1slja1: