SCOPe 2.06: Domain d1slja1: 1slj A:35-125

Lineage for d1slja1 (1slj A:35-125)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein S1-domain of Ribonuclease E [110198] (1 species)

7. Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
   Uniprot P21513 35-125

8. Domain d1slja1: 1slj A:35-125 [105718]
   Other proteins in same PDB: d1slja2

Details for d1slja1

PDB Entry: 1slj

PDB Description: solution structure of the s1 domain of rnase e from e. coli

PDB Compounds: (A:) Ribonuclease E

SCOPe Domain Sequences for d1slja1:

Sequence; same for both SEQRES and ATOM records:

>d1slja1 b.40.4.5 (A:35-125) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]}
eqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvl
regqevivqidkeergnkgaalttfislags

Timeline for d1slja1:

• d1slja1 first appeared in SCOP 1.69, called d1slja_
  
• d1slja1 was called d1slja_ in SCOPe 2.05
  
• d1slja1 appears in SCOPe 2.07
  
• d1slja1 appears in the current release, SCOPe 2.08