Lineage for d1slja_ (1slj A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463871Protein S1-domain of Ribonuclease E [110198] (1 species)
  7. 463872Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
  8. 463877Domain d1slja_: 1slj A: [105718]

Details for d1slja_

PDB Entry: 1slj (more details)

PDB Description: solution structure of the s1 domain of rnase e from e. coli

SCOP Domain Sequences for d1slja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slja_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli}
gshmleqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpn
ikdvlregqevivqidkeergnkgaalttfislags

SCOP Domain Coordinates for d1slja_:

Click to download the PDB-style file with coordinates for d1slja_.
(The format of our PDB-style files is described here.)

Timeline for d1slja_: