SCOP 1.73: Domain d1sl6f_: 1sl6 F:

Lineage for d1sl6f_ (1sl6 F:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries)

8. Domain d1sl6f_: 1sl6 F: [105717]
   contains two repeats of neck
   complexed with ca, fuc, gal, nag

Details for d1sl6f_

PDB Entry: 1sl6, 2.25 Å

PDB Description: crystal structure of a fragment of dc-signr (containg the carbohydrate recognition domain and two repeats of the neck) complexed with lewis- x.

PDB Compounds: (F:) C-type lectin DC-SIGNR

SCOP Domain Sequences for d1sl6f_:

Sequence, based on SEQRES records:

>d1sl6f_ d.169.1.1 (F:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn
cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt
wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Sequence, based on observed residues (ATOM records):

>d1sl6f_ d.169.1.1 (F:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Timeline for d1sl6f_:

• d1sl6f_ first appeared in SCOP 1.69
  
• d1sl6f_ appears in SCOP 1.71
  
• d1sl6f_ appears in SCOP 1.75
  
• d1sl6f_ appears in the current release, SCOPe 2.08