Lineage for d1sl6e_ (1sl6 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
    Uniprot Q9NNX6 219-397
  8. 2234683Domain d1sl6e_: 1sl6 E: [105716]
    contains two repeats of neck
    complexed with ca

Details for d1sl6e_

PDB Entry: 1sl6 (more details), 2.25 Å

PDB Description: Crystal Structure of a fragment of DC-SIGNR (containg the carbohydrate recognition domain and two repeats of the neck) complexed with Lewis-x.
PDB Compounds: (E:) C-type lectin DC-SIGNR

SCOPe Domain Sequences for d1sl6e_:

Sequence, based on SEQRES records: (download)

>d1sl6e_ d.169.1.1 (E:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn
cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt
wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Sequence, based on observed residues (ATOM records): (download)

>d1sl6e_ d.169.1.1 (E:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

SCOPe Domain Coordinates for d1sl6e_:

Click to download the PDB-style file with coordinates for d1sl6e_.
(The format of our PDB-style files is described here.)

Timeline for d1sl6e_: