SCOP 1.71: Domain d1sl6e_: 1sl6 E:

Lineage for d1sl6e_ (1sl6 E:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)

8. Domain d1sl6e_: 1sl6 E: [105716]

Details for d1sl6e_

PDB Entry: 1sl6, 2.25 Å

PDB Description: crystal structure of a fragment of dc-signr (containg the carbohydrate recognition domain and two repeats of the neck) complexed with lewis- x.

SCOP Domain Sequences for d1sl6e_:

Sequence, based on SEQRES records:

>d1sl6e_ d.169.1.1 (E:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn
cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt
wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Sequence, based on observed residues (ATOM records):

>d1sl6e_ d.169.1.1 (E:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Timeline for d1sl6e_:

• d1sl6e_ first appeared in SCOP 1.69
  
• d1sl6e_ appears in SCOP 1.73
  
• d1sl6e_ appears in the current release, SCOPe 2.08