Lineage for d1sl3a_ (1sl3 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546204Protein Thrombin [50531] (2 species)
  7. 1546240Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 1546263Domain d1sl3a_: 1sl3 A: [105709]
    complexed with 170

Details for d1sl3a_

PDB Entry: 1sl3 (more details), 1.81 Å

PDB Description: crystal structue of thrombin in complex with a potent p1 heterocycle- aryl based inhibitor
PDB Compounds: (A:) thrombin

SCOPe Domain Sequences for d1sl3a_:

Sequence, based on SEQRES records: (download)

>d1sl3a_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Sequence, based on observed residues (ATOM records): (download)

>d1sl3a_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
givswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOPe Domain Coordinates for d1sl3a_:

Click to download the PDB-style file with coordinates for d1sl3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sl3a_: