Lineage for d1sl2a1 (1sl2 A:1-210)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488631Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 488728Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 488729Species Bacteriophage T7 [TaxId:10760] [53124] (11 PDB entries)
  8. 488736Domain d1sl2a1: 1sl2 A:1-210 [105706]
    Other proteins in same PDB: d1sl2a2, d1sl2b_

Details for d1sl2a1

PDB Entry: 1sl2 (more details), 2.3 Å

PDB Description: Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide

SCOP Domain Sequences for d1sl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl2a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOP Domain Coordinates for d1sl2a1:

Click to download the PDB-style file with coordinates for d1sl2a1.
(The format of our PDB-style files is described here.)

Timeline for d1sl2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sl2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sl2b_