SCOP 1.71: Domain d1sl1b_: 1sl1 B:

Lineage for d1sl1b_ (1sl1 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.1: Thioltransferase [52834] (13 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (25 PDB entries)

8. Domain d1sl1b_: 1sl1 B: [105705]
   Other proteins in same PDB: d1sl1a1, d1sl1a2
   complexed with 2da, mg, ttd; mutant

Details for d1sl1b_

PDB Entry: 1sl1, 2.2 Å

PDB Description: Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template

SCOP Domain Sequences for d1sl1b_:

Sequence; same for both SEQRES and ATOM records:

>d1sl1b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1sl1b_:

• d1sl1b_ first appeared in SCOP 1.69
  
• d1sl1b_ appears in SCOP 1.73
  
• d1sl1b_ appears in the current release, SCOPe 2.08