SCOP 1.69: Domain d1sl0d_: 1sl0 D:

Lineage for d1sl0d_ (1sl0 D:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.1: Thioltransferase [52834] (11 proteins)

6. Protein Thioredoxin [52835] (10 species)

7. Species Escherichia coli [TaxId:562] [52836] (21 PDB entries)

8. Domain d1sl0d_: 1sl0 D: [105702]
   Other proteins in same PDB: d1sl0a1, d1sl0a2, d1sl0c1, d1sl0c2

Details for d1sl0d_

PDB Entry: 1sl0, 3.2 Å

PDB Description: Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide

SCOP Domain Sequences for d1sl0d_:

Sequence; same for both SEQRES and ATOM records:

>d1sl0d_ c.47.1.1 (D:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1sl0d_:

• d1sl0d_ is new in SCOP 1.69
  
• d1sl0d_ appears in SCOP 1.71
  
• d1sl0d_ appears in the current release, SCOPe 2.08