![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [52836] (55 PDB entries) Uniprot P00274 ! Uniprot P00581 |
![]() | Domain d1sl0b_: 1sl0 B: [105699] Other proteins in same PDB: d1sl0a1, d1sl0a2, d1sl0c1, d1sl0c2 protein/DNA complex; complexed with dad, mg |
PDB Entry: 1sl0 (more details), 3.2 Å
SCOPe Domain Sequences for d1sl0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sl0b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]} kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
Timeline for d1sl0b_: