Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins) |
Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species) |
Species Bacteriophage T7 [TaxId:10760] [53124] (11 PDB entries) |
Domain d1sl0a1: 1sl0 A:1-210 [105697] Other proteins in same PDB: d1sl0a2, d1sl0b_, d1sl0c2, d1sl0d_ |
PDB Entry: 1sl0 (more details), 3.2 Å
SCOP Domain Sequences for d1sl0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sl0a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7} mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll sdkhyfppeidftdvgyttfwses
Timeline for d1sl0a1:
View in 3D Domains from other chains: (mouse over for more information) d1sl0b_, d1sl0c1, d1sl0c2, d1sl0d_ |