Lineage for d1skvd_ (1skv D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442133Fold a.30: ROP-like [47379] (5 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 442183Superfamily a.30.5: Hypothetical protein D-63 [109801] (1 family) (S)
  5. 442184Family a.30.5.1: Hypothetical protein D-63 [109802] (1 protein)
  6. 442185Protein Hypothetical protein D-63 [109803] (1 species)
  7. 442186Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109804] (1 PDB entry)
  8. 442190Domain d1skvd_: 1skv D: [105693]

Details for d1skvd_

PDB Entry: 1skv (more details), 2.6 Å

PDB Description: Crystal Structure of D-63 from Sulfolobus Spindle Virus 1

SCOP Domain Sequences for d1skvd_:

Sequence, based on SEQRES records: (download)

>d1skvd_ a.30.5.1 (D:) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1}
skevlekelfemldedvrellsliheikidritgnmdkqklgkayfqvqkieaelyqlik
vshhh

Sequence, based on observed residues (ATOM records): (download)

>d1skvd_ a.30.5.1 (D:) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1}
skevlekelfemldedvrellsliheikkqklgkayfqvqkieaelyqlikvshhh

SCOP Domain Coordinates for d1skvd_:

Click to download the PDB-style file with coordinates for d1skvd_.
(The format of our PDB-style files is described here.)

Timeline for d1skvd_: