Lineage for d1skvd1 (1skv D:2-63)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993437Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1993516Superfamily a.30.5: Hypothetical protein D-63 [109801] (1 family) (S)
  5. 1993517Family a.30.5.1: Hypothetical protein D-63 [109802] (1 protein)
  6. 1993518Protein Hypothetical protein D-63 [109803] (1 species)
  7. 1993519Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109804] (1 PDB entry)
    Uniprot P20215
  8. 1993523Domain d1skvd1: 1skv D:2-63 [105693]
    Other proteins in same PDB: d1skva2, d1skvb2, d1skvc2, d1skvd2

Details for d1skvd1

PDB Entry: 1skv (more details), 2.6 Å

PDB Description: Crystal Structure of D-63 from Sulfolobus Spindle Virus 1
PDB Compounds: (D:) Hypothetical 7.5 kDa protein

SCOPe Domain Sequences for d1skvd1:

Sequence, based on SEQRES records: (download)

>d1skvd1 a.30.5.1 (D:2-63) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
skevlekelfemldedvrellsliheikidritgnmdkqklgkayfqvqkieaelyqlik
vs

Sequence, based on observed residues (ATOM records): (download)

>d1skvd1 a.30.5.1 (D:2-63) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
skevlekelfemldedvrellsliheikkqklgkayfqvqkieaelyqlikvs

SCOPe Domain Coordinates for d1skvd1:

Click to download the PDB-style file with coordinates for d1skvd1.
(The format of our PDB-style files is described here.)

Timeline for d1skvd1: