Lineage for d1skvc_ (1skv C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732492Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1732571Superfamily a.30.5: Hypothetical protein D-63 [109801] (1 family) (S)
  5. 1732572Family a.30.5.1: Hypothetical protein D-63 [109802] (1 protein)
  6. 1732573Protein Hypothetical protein D-63 [109803] (1 species)
  7. 1732574Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109804] (1 PDB entry)
    Uniprot P20215
  8. 1732577Domain d1skvc_: 1skv C: [105692]

Details for d1skvc_

PDB Entry: 1skv (more details), 2.6 Å

PDB Description: Crystal Structure of D-63 from Sulfolobus Spindle Virus 1
PDB Compounds: (C:) Hypothetical 7.5 kDa protein

SCOPe Domain Sequences for d1skvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skvc_ a.30.5.1 (C:) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
ekelfemldedvrellsliheikidritgnmdkqklgkayfqvqkieaelyqlikvsh

SCOPe Domain Coordinates for d1skvc_:

Click to download the PDB-style file with coordinates for d1skvc_.
(The format of our PDB-style files is described here.)

Timeline for d1skvc_: