Class a: All alpha proteins [46456] (289 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.5: Hypothetical protein D-63 [109801] (1 family) |
Family a.30.5.1: Hypothetical protein D-63 [109802] (1 protein) |
Protein Hypothetical protein D-63 [109803] (1 species) |
Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109804] (1 PDB entry) Uniprot P20215 |
Domain d1skvb1: 1skv B:6-63 [105691] Other proteins in same PDB: d1skva2, d1skvb2, d1skvc2, d1skvd2 |
PDB Entry: 1skv (more details), 2.6 Å
SCOPe Domain Sequences for d1skvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skvb1 a.30.5.1 (B:6-63) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]} lekelfemldedvrellsliheikidritgnmdkqklgkayfqvqkieaelyqlikvs
Timeline for d1skvb1: