![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.5: Hypothetical protein D-63 [109801] (1 family) ![]() |
![]() | Family a.30.5.1: Hypothetical protein D-63 [109802] (1 protein) |
![]() | Protein Hypothetical protein D-63 [109803] (1 species) |
![]() | Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109804] (1 PDB entry) Uniprot P20215 |
![]() | Domain d1skvb_: 1skv B: [105691] |
PDB Entry: 1skv (more details), 2.6 Å
SCOPe Domain Sequences for d1skvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skvb_ a.30.5.1 (B:) Hypothetical protein D-63 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]} lekelfemldedvrellsliheikidritgnmdkqklgkayfqvqkieaelyqlikvshh h
Timeline for d1skvb_: