SCOPe 2.07: Domain d1sksb_: 1sks B:

Lineage for d1sksb_ (1sks B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1sksb_: 1sks B: [105689]
   Other proteins in same PDB: d1sksa1, d1sksa2
   protein/DNA complex; complexed with mg

Details for d1sksb_

PDB Entry: 1sks, 2.3 Å

PDB Description: Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template

PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1sksb_:

Sequence; same for both SEQRES and ATOM records:

>d1sksb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1sksb_:

• d1sksb_ first appeared in SCOP 1.69
  
• d1sksb_ appears in SCOPe 2.06
  
• d1sksb_ appears in the current release, SCOPe 2.08