SCOP 1.71: Domain d1skrb_: 1skr B:

Lineage for d1skrb_ (1skr B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.1: Thioltransferase [52834] (13 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (25 PDB entries)

8. Domain d1skrb_: 1skr B: [105686]
   Other proteins in same PDB: d1skra1, d1skra2
   complexed with 2da, dad, mg; mutant

Details for d1skrb_

PDB Entry: 1skr, 2.4 Å

PDB Description: t7 dna polymerase complexed to dna primer/template and ddatp

SCOP Domain Sequences for d1skrb_:

Sequence; same for both SEQRES and ATOM records:

>d1skrb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1skrb_:

• d1skrb_ first appeared in SCOP 1.69
  
• d1skrb_ appears in SCOP 1.73
  
• d1skrb_ appears in the current release, SCOPe 2.08