SCOP 1.69: Domain d1skra1: 1skr A:1-210

Lineage for d1skra1 (1skr A:1-210)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53124] (11 PDB entries)

8. Domain d1skra1: 1skr A:1-210 [105684]
   Other proteins in same PDB: d1skra2, d1skrb_

Details for d1skra1

PDB Entry: 1skr, 2.4 Å

PDB Description: t7 dna polymerase complexed to dna primer/template and ddatp

SCOP Domain Sequences for d1skra1:

Sequence; same for both SEQRES and ATOM records:

>d1skra1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

Timeline for d1skra1:

• d1skra1 is new in SCOP 1.69
  
• d1skra1 appears in SCOP 1.71
  
• d1skra1 appears in the current release, SCOPe 2.08