SCOPe 2.08: Domain d1skqb2: 1skq B:323-430

Lineage for d1skqb2 (1skq B:323-430)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries)
   Uniprot P35021

8. Domain d1skqb2: 1skq B:323-430 [105682]
   Other proteins in same PDB: d1skqa1, d1skqa3, d1skqb1, d1skqb3
   complexed with gdp, mg

Details for d1skqb2

PDB Entry: 1skq, 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp

PDB Compounds: (B:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1skqb2:

Sequence; same for both SEQRES and ATOM records:

>d1skqb2 b.44.1.1 (B:323-430) Elongation factor eEF-1alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa

Timeline for d1skqb2:

• d1skqb2 first appeared in SCOP 1.69
  
• d1skqb2 appears in SCOPe 2.07