SCOP 1.71: Domain d1skqb1: 1skq B:228-322

Lineage for d1skqb1 (1skq B:228-322)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (3 families)

5. Family b.43.3.1: Elongation factors [50448] (9 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)

8. Domain d1skqb1: 1skq B:228-322 [105681]
   Other proteins in same PDB: d1skqa2, d1skqa3, d1skqb2, d1skqb3
   complexed with gdp, mg

Details for d1skqb1

PDB Entry: 1skq, 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp

SCOP Domain Sequences for d1skqb1:

Sequence; same for both SEQRES and ATOM records:

>d1skqb1 b.43.3.1 (B:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

Timeline for d1skqb1:

• d1skqb1 first appeared in SCOP 1.69
  
• d1skqb1 appears in SCOP 1.73
  
• d1skqb1 appears in the current release, SCOPe 2.08