Lineage for d1skqa3 (1skq A:4-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124522Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2124530Species Sulfolobus solfataricus [TaxId:2287] [69487] (2 PDB entries)
    Uniprot P35021
  8. 2124531Domain d1skqa3: 1skq A:4-227 [105680]
    Other proteins in same PDB: d1skqa1, d1skqa2, d1skqb1, d1skqb2
    complexed with gdp, mg

Details for d1skqa3

PDB Entry: 1skq (more details), 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1skqa3:

Sequence, based on SEQRES records: (download)

>d1skqa3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppk

Sequence, based on observed residues (ATOM records): (download)

>d1skqa3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eemrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtre
hiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvva
psgdnithksenmkwyngptleeyldqlelppk

SCOPe Domain Coordinates for d1skqa3:

Click to download the PDB-style file with coordinates for d1skqa3.
(The format of our PDB-style files is described here.)

Timeline for d1skqa3: