Lineage for d1skqa2 (1skq A:323-430)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792477Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1792478Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 1792486Species Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries)
    Uniprot P35021
  8. 1792487Domain d1skqa2: 1skq A:323-430 [105679]
    Other proteins in same PDB: d1skqa1, d1skqa3, d1skqb1, d1skqb3
    complexed with gdp, mg

Details for d1skqa2

PDB Entry: 1skq (more details), 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1skqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skqa2 b.44.1.1 (A:323-430) Elongation factor eEF-1alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa

SCOPe Domain Coordinates for d1skqa2:

Click to download the PDB-style file with coordinates for d1skqa2.
(The format of our PDB-style files is described here.)

Timeline for d1skqa2: