SCOP 1.75: Domain d1skqa2: 1skq A:323-430

Lineage for d1skqa2 (1skq A:323-430)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries)
   Uniprot P35021

8. Domain d1skqa2: 1skq A:323-430 [105679]
   Other proteins in same PDB: d1skqa1, d1skqa3, d1skqb1, d1skqb3

Details for d1skqa2

PDB Entry: 1skq, 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp

PDB Compounds: (A:) Elongation factor 1-alpha

SCOP Domain Sequences for d1skqa2:

Sequence; same for both SEQRES and ATOM records:

>d1skqa2 b.44.1.1 (A:323-430) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa

Timeline for d1skqa2:

• d1skqa2 first appeared in SCOP 1.69
  
• d1skqa2 appears in SCOP 1.73
  
• d1skqa2 appears in SCOPe 2.01
  
• d1skqa2 appears in the current release, SCOPe 2.08