Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [111124] (5 PDB entries) Uniprot Q9JHS3 |
Domain d1skob_: 1sko B: [105677] Other proteins in same PDB: d1skoa1, d1skoa2 |
PDB Entry: 1sko (more details), 2 Å
SCOPe Domain Sequences for d1skob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skob_ d.110.7.1 (B:) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]} pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqa fnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
Timeline for d1skob_: