Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein MEK binding partner 1, MP1 [111120] (2 species) remote homolog that forms the characteristic complex structures with other members |
Species Human (Homo sapiens) [TaxId:9606] [111121] (3 PDB entries) Uniprot Q9UHA4 |
Domain d1skoa_: 1sko A: [105676] Other proteins in same PDB: d1skob_ |
PDB Entry: 1sko (more details), 2 Å
SCOPe Domain Sequences for d1skoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skoa_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Human (Homo sapiens) [TaxId: 9606]} gsaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdq gsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelr
Timeline for d1skoa_: