SCOP 1.71: Domain d1skoa_: 1sko A:

Lineage for d1skoa_ (1sko A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
   Pfam 03259

6. Protein MEK binding partner 1, MP1 [111120] (2 species)
   remote homolog that forms the characteristic complex structures with other members

7. Species Human (Homo sapiens) [TaxId:9606] [111121] (1 PDB entry)

8. Domain d1skoa_: 1sko A: [105676]
   Other proteins in same PDB: d1skob_

Details for d1skoa_

PDB Entry: 1sko, 2 Å

PDB Description: MP1-p14 Complex

SCOP Domain Sequences for d1skoa_:

Sequence; same for both SEQRES and ATOM records:

>d1skoa_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Human (Homo sapiens)}
gsaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdq
gsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelr

Timeline for d1skoa_:

• d1skoa_ first appeared in SCOP 1.69
  
• d1skoa_ appears in SCOP 1.73
  
• d1skoa_ appears in the current release, SCOPe 2.08, called d1skoa1