SCOPe 2.08: Domain d1skoa1: 1sko A:3-119

Lineage for d1skoa1 (1sko A:3-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein MEK binding partner 1, MP1 [111120] (2 species)
   remote homolog that forms the characteristic complex structures with other members

7. Species Human (Homo sapiens) [TaxId:9606] [111121] (3 PDB entries)
   Uniprot Q9UHA4

8. Domain d1skoa1: 1sko A:3-119 [105676]
   Other proteins in same PDB: d1skoa2, d1skob_

Details for d1skoa1

PDB Entry: 1sko, 2 Å

PDB Description: MP1-p14 Complex

PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1 interacting protein 1

SCOPe Domain Sequences for d1skoa1:

Sequence; same for both SEQRES and ATOM records:

>d1skoa1 d.110.7.1 (A:3-119) MEK binding partner 1, MP1 {Human (Homo sapiens) [TaxId: 9606]}
addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelr

Timeline for d1skoa1:

• d1skoa1 first appeared in SCOP 1.69, called d1skoa_
  
• d1skoa1 appears in SCOPe 2.07