Lineage for d1skoa1 (1sko A:3-119)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2535341Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2535342Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2535365Protein MEK binding partner 1, MP1 [111120] (2 species)
    remote homolog that forms the characteristic complex structures with other members
  7. 2535366Species Human (Homo sapiens) [TaxId:9606] [111121] (3 PDB entries)
    Uniprot Q9UHA4
  8. 2535369Domain d1skoa1: 1sko A:3-119 [105676]
    Other proteins in same PDB: d1skoa2, d1skob_

Details for d1skoa1

PDB Entry: 1sko (more details), 2 Å

PDB Description: MP1-p14 Complex
PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1 interacting protein 1

SCOPe Domain Sequences for d1skoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skoa1 d.110.7.1 (A:3-119) MEK binding partner 1, MP1 {Human (Homo sapiens) [TaxId: 9606]}
addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelr

SCOPe Domain Coordinates for d1skoa1:

Click to download the PDB-style file with coordinates for d1skoa1.
(The format of our PDB-style files is described here.)

Timeline for d1skoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1skoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1skob_