Lineage for d1skma_ (1skm A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588970Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 588975Protein DNA methylase HhaI [53367] (1 species)
  7. 588976Species Haemophilus haemolyticus [TaxId:726] [53368] (15 PDB entries)
  8. 588978Domain d1skma_: 1skm A: [105675]
    complexed with hcx, sah

Details for d1skma_

PDB Entry: 1skm (more details), 2.2 Å

PDB Description: HhaI methyltransferase in complex with DNA containing an abasic south carbocyclic sugar at its target site

SCOP Domain Sequences for d1skma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skma_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d1skma_:

Click to download the PDB-style file with coordinates for d1skma_.
(The format of our PDB-style files is described here.)

Timeline for d1skma_: