Lineage for d1sk9a_ (1sk9 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489762Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 489763Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 489803Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)
  6. 489808Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 489811Species Aspergillus fumigatus [TaxId:5085] [110657] (4 PDB entries)
  8. 489814Domain d1sk9a_: 1sk9 A: [105672]

Details for d1sk9a_

PDB Entry: 1sk9 (more details), 1.64 Å

PDB Description: Crystallographic snapshots of Aspergillus fumigatus phytase revealing its enzymatic dynamics

SCOP Domain Sequences for d1sk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sk9a_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus}
cdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryptss
kskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqrykal
arsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnntld
hgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdtvar
tsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarltrsp
vqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsvesake
ldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklndfvk
glswarsggnwgecf

SCOP Domain Coordinates for d1sk9a_:

Click to download the PDB-style file with coordinates for d1sk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1sk9a_: