Lineage for d1sk7a_ (1sk7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011564Family a.132.1.2: Heme oxygenase HemO (PigA) [63627] (1 protein)
    automatically mapped to Pfam PF01126
  6. 2011565Protein Heme oxygenase HemO (PigA) [63628] (2 species)
    gram-negative bacterial heme oxygenase/iron-starvation protein
  7. 2011571Species Pseudomonas aeruginosa [TaxId:287] [110027] (1 PDB entry)
    Uniprot O69002
  8. 2011572Domain d1sk7a_: 1sk7 A: [105671]
    complexed with hem, so4

Details for d1sk7a_

PDB Entry: 1sk7 (more details), 1.6 Å

PDB Description: Structural Basis for Novel Delta-Regioselective Heme Oxygenation in the Opportunistic Pathogen Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein pa-HO

SCOPe Domain Sequences for d1sk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sk7a_ a.132.1.2 (A:) Heme oxygenase HemO (PigA) {Pseudomonas aeruginosa [TaxId: 287]}
nlrsqrlnlltnephqrleslvkskepfasrdnfarfvaaqylfqhdleplyrnealarl
fpglasrarddaaradladlghpvpegdqsvreadlslaealgwlfvsegsklgaaflfk
kaaaleldenfgarhlaepeggraqgwksfvaildgielneeeerlaakgasdafnrfgd
llertfa

SCOPe Domain Coordinates for d1sk7a_:

Click to download the PDB-style file with coordinates for d1sk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1sk7a_: