Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (38 PDB entries) Uniprot P02593 |
Domain d1sk6e_: 1sk6 E: [105669] Other proteins in same PDB: d1sk6a_, d1sk6b_, d1sk6c_ |
PDB Entry: 1sk6 (more details), 3.2 Å
SCOP Domain Sequences for d1sk6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sk6e_ a.39.1.5 (E:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmta
Timeline for d1sk6e_: