Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
Protein Peptidoglycan recognition protein I-alpha [111141] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries) Uniprot Q96LB9 177-341 |
Domain d1sk4a_: 1sk4 A: [105664] complexed with na |
PDB Entry: 1sk4 (more details), 1.65 Å
SCOPe Domain Sequences for d1sk4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sk4a_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]} pniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrnfc digyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqdli qcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
Timeline for d1sk4a_: