Lineage for d1sk4a_ (1sk4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212615Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2212616Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2212617Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2212649Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 2212650Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries)
    Uniprot Q96LB9 177-341
  8. 2212651Domain d1sk4a_: 1sk4 A: [105664]
    complexed with na

Details for d1sk4a_

PDB Entry: 1sk4 (more details), 1.65 Å

PDB Description: crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
PDB Compounds: (A:) Peptidoglycan recognition protein I-alpha

SCOPe Domain Sequences for d1sk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sk4a_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
pniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrnfc
digyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqdli
qcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOPe Domain Coordinates for d1sk4a_:

Click to download the PDB-style file with coordinates for d1sk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sk4a_: