Lineage for d1sjva_ (1sjv A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450784Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 450813Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)
  8. 450814Domain d1sjva_: 1sjv A: [105662]
    swapped dimer

Details for d1sjva_

PDB Entry: 1sjv (more details), 1.94 Å

PDB Description: Three-Dimensional Structure of a Llama VHH Domain Swapping

SCOP Domain Sequences for d1sjva_:

Sequence, based on SEQRES records: (download)

>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama)}
ggglvqageslklscaasgntfsggfmgwyrqapgkqrelvatinsrgitnyadfvkgrf
tisrdnakktvylemnslepedtavyycythyfrsywgqgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama)}
ggglvqageslklscaasggfmgwyrqapgkqrelvatinsrgitnyadfvkgrftisrd
nakktvylemnslepedtavyycythyfrsywgqgtqvtvss

SCOP Domain Coordinates for d1sjva_:

Click to download the PDB-style file with coordinates for d1sjva_.
(The format of our PDB-style files is described here.)

Timeline for d1sjva_: