Lineage for d1sjva_ (1sjv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739573Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)
  8. 2739574Domain d1sjva_: 1sjv A: [105662]
    swapped dimer

Details for d1sjva_

PDB Entry: 1sjv (more details), 1.94 Å

PDB Description: Three-Dimensional Structure of a Llama VHH Domain Swapping
PDB Compounds: (A:) r9

SCOPe Domain Sequences for d1sjva_:

Sequence, based on SEQRES records: (download)

>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
ggglvqageslklscaasgntfsggfmgwyrqapgkqrelvatinsrgitnyadfvkgrf
tisrdnakktvylemnslepedtavyycythyfrsywgqgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
ggglvqageslklscaasggfmgwyrqapgkqrelvatinsrgitnyadfvkgrftisrd
nakktvylemnslepedtavyycythyfrsywgqgtqvtvss

SCOPe Domain Coordinates for d1sjva_:

Click to download the PDB-style file with coordinates for d1sjva_.
(The format of our PDB-style files is described here.)

Timeline for d1sjva_: