Lineage for d1sjra_ (1sjr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195256Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 2195257Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
    Uniprot P26599 54-141, 177-284, 335-531
  8. 2195263Domain d1sjra_: 1sjr A: [105661]
    RR2

Details for d1sjra_

PDB Entry: 1sjr (more details)

PDB Description: nmr structure of rrm2 from human polypyrimidine tract binding protein isoform 1 (ptb1)
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d1sjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjra_ d.58.7.1 (A:) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
magqspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqh
aklsldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd

SCOPe Domain Coordinates for d1sjra_:

Click to download the PDB-style file with coordinates for d1sjra_.
(The format of our PDB-style files is described here.)

Timeline for d1sjra_: