![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Polypyrimidine tract-binding protein [54950] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries) Uniprot P26599 54-141, 177-284, 335-531 |
![]() | Domain d1sjqa1: 1sjq A:13-99 [105660] Other proteins in same PDB: d1sjqa2 RR1 |
PDB Entry: 1sjq (more details)
SCOPe Domain Sequences for d1sjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjqa1 d.58.7.1 (A:13-99) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} gvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaantmvnyy tsvtpvlrgqpiyiqfsnhkelktdss
Timeline for d1sjqa1: