SCOPe 2.08: Domain d1sjqa1: 1sjq A:13-99

Lineage for d1sjqa1 (1sjq A:13-99)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Polypyrimidine tract-binding protein [54950] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
   Uniprot P26599 54-141, 177-284, 335-531

8. Domain d1sjqa1: 1sjq A:13-99 [105660]
   Other proteins in same PDB: d1sjqa2
   RR1

Details for d1sjqa1

PDB Entry: 1sjq

PDB Description: nmr structure of rrm1 from human polypyrimidine tract binding protein isoform 1 (ptb1)

PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d1sjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1sjqa1 d.58.7.1 (A:13-99) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
gvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaantmvnyy
tsvtpvlrgqpiyiqfsnhkelktdss

Timeline for d1sjqa1:

• d1sjqa1 first appeared in SCOP 1.69, called d1sjqa_
  
• d1sjqa1 appears in SCOPe 2.07