SCOPe 2.03: Domain d1sjmb1: 1sjm B:5-166

Lineage for d1sjmb1 (1sjm B:5-166)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (37 PDB entries)
   Uniprot P38501

8. Domain d1sjmb1: 1sjm B:5-166 [105656]
   complexed with act, cu, no2, trs

Details for d1sjmb1

PDB Entry: 1sjm, 1.4 Å

PDB Description: nitrite bound copper containing nitrite reductase

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1sjmb1:

Sequence; same for both SEQRES and ATOM records:

>d1sjmb1 b.6.1.3 (B:5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

Timeline for d1sjmb1:

• d1sjmb1 first appeared in SCOP 1.69
  
• d1sjmb1 appears in SCOPe 2.02
  
• d1sjmb1 appears in SCOPe 2.04
  
• d1sjmb1 appears in the current release, SCOPe 2.08