Lineage for d1sjma2 (1sjm A:167-339)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458069Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 458107Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)
  8. 458115Domain d1sjma2: 1sjm A:167-339 [105655]

Details for d1sjma2

PDB Entry: 1sjm (more details), 1.4 Å

PDB Description: nitrite bound copper containing nitrite reductase

SCOP Domain Sequences for d1sjma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjma2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOP Domain Coordinates for d1sjma2:

Click to download the PDB-style file with coordinates for d1sjma2.
(The format of our PDB-style files is described here.)

Timeline for d1sjma2: