Lineage for d1sjhd1 (1sjh D:1-121)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463299Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 463300Species Staphylococcus aureus [TaxId:1280] [50229] (10 PDB entries)
  8. 463303Domain d1sjhd1: 1sjh D:1-121 [105652]
    Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhb2, d1sjhd2

Details for d1sjhd1

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide

SCOP Domain Sequences for d1sjhd1:

Sequence, based on SEQRES records: (download)

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

SCOP Domain Coordinates for d1sjhd1:

Click to download the PDB-style file with coordinates for d1sjhd1.
(The format of our PDB-style files is described here.)

Timeline for d1sjhd1: