Lineage for d1sjhd1 (1sjh D:1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050816Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 protein domains)
  6. 2050881Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2050882Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2050895Domain d1sjhd1: 1sjh D:1-121 [105652]
    Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhb2, d1sjhd2

Details for d1sjhd1

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1sjhd1:

Sequence, based on SEQRES records: (download)

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

SCOPe Domain Coordinates for d1sjhd1:

Click to download the PDB-style file with coordinates for d1sjhd1.
(The format of our PDB-style files is described here.)

Timeline for d1sjhd1: