SCOP 1.69: Domain d1sjhb2: 1sjh B:1-92

Lineage for d1sjhb2 (1sjh B:1-92)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (10 PDB entries)

8. Domain d1sjhb2: 1sjh B:1-92 [105651]
   Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhd1, d1sjhd2

Details for d1sjhb2

PDB Entry: 1sjh, 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide

SCOP Domain Sequences for d1sjhb2:

Sequence; same for both SEQRES and ATOM records:

>d1sjhb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1sjhb2:

• d1sjhb2 is new in SCOP 1.69
  
• d1sjhb2 appears in SCOP 1.71
  
• d1sjhb2 appears in the current release, SCOPe 2.08