Lineage for d1sjhb1 (1sjh B:93-190)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453132Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 453140Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 453147Domain d1sjhb1: 1sjh B:93-190 [105650]
    Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb2, d1sjhd1, d1sjhd2

Details for d1sjhb1

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide

SCOP Domain Sequences for d1sjhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjhb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1sjhb1:

Click to download the PDB-style file with coordinates for d1sjhb1.
(The format of our PDB-style files is described here.)

Timeline for d1sjhb1: