Class b: All beta proteins [48724] (144 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (2 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species) |
Species Pseudomonas mendocina [TaxId:300] [110155] (2 PDB entries) |
Domain d1sjga_: 1sjg A: [105647] |
PDB Entry: 1sjg (more details)
SCOP Domain Sequences for d1sjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjga_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina} msfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyegg vitcrahlwtfndgtghginpddcclaeypvevkgddiyvstkgilpnkahs
Timeline for d1sjga_: